PDB entry 2ffj

View 2ffj on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a DUF89 family protein (AF1104) FROM ARCHAEOGLOBUS FULGIDUS DSM 4304 AT 2.45 A RESOLUTION
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on 2005-12-19, released 2006-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: 2649480
    Database cross-references and differences (RAF-indexed):
    • GB AAB90134 (Start-299)
      • modified residue (183)
      • modified residue (235)
      • modified residue (257)
      • modified residue (293)
    Domains in SCOPe 2.07: d2ffja1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: 2649480
    Database cross-references and differences (RAF-indexed):
    • GB AAB90134 (Start-299)
      • modified residue (183)
      • modified residue (235)
      • modified residue (257)
      • modified residue (293)
    Domains in SCOPe 2.07: d2ffjb_
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ffjA (A:)
    mgsdkihhhhhhmkisplcpscllgrvyyeaklvtddedlisqcvdeslkilaenyssrp
    inahlatrihrrvyeilgvedpyaevkaranevarqvlplakeivegsddpfktavivsi
    vgnnfdygvqghkvveeefrdflkrkvqeglkindterikelssgkvvyltdnageiffd
    tllmkeikrrcekltavvrgrpiisdatiedarlarvdkiadelltngkgaigiimdelp
    detrkaleeadlivakgmanyeclsdgslkpiaflltakcepvardigvnvgdmvakvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffjA (A:)
    cpscllgrvyyeaklvtddedlisqcvdeslkilaeninahlatrihrrvyeilgvedpy
    aevkaranevarqvlplakeivegsddpfktavivsivgnnfdyvveeefrdflkrkvqe
    glkindterikelssgkvvyltdnageiffdtllmkeikrrcekltavvrgrpiisdati
    edarlarvdkiadelltngkgaigiimdelpdetrkaleeadlivakgmanyeclslkpi
    aflltakcepvardigvnvgdmvakvve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ffjB (B:)
    mgsdkihhhhhhmkisplcpscllgrvyyeaklvtddedlisqcvdeslkilaenyssrp
    inahlatrihrrvyeilgvedpyaevkaranevarqvlplakeivegsddpfktavivsi
    vgnnfdygvqghkvveeefrdflkrkvqeglkindterikelssgkvvyltdnageiffd
    tllmkeikrrcekltavvrgrpiisdatiedarlarvdkiadelltngkgaigiimdelp
    detrkaleeadlivakgmanyeclsdgslkpiaflltakcepvardigvnvgdmvakvve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffjB (B:)
    cpscllgrvyyeaklvtddedlisqcvdeslkilaeninahlatrihrrvyeilgvedpy
    aevkaranevarqvlplakeivegsddpfktavivsivgnnfhkvveeefrdflkrkvqe
    glkindterikelssgkvvyltdnageiffdtllmkeikrrcekltavvrgrpiisdati
    edarlarvdkiadelltngkgaigiimdelpdetrkaleeadlivakgmanyeclsdgsl
    kpiaflltakcepvardigvnvgdmvakvve