PDB entry 2ffh

View 2ffh on RCSB PDB site
Description: the signal sequence binding protein ffh from thermus aquaticus
Deposited on 1999-06-29, released 1999-07-16
The last revision prior to the SCOP 1.67 freeze date was dated 1999-07-16, with a file datestamp of 1999-07-15.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.257
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ffhA (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraagleaeapksakelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaik
    rleaivlsmtpeerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslekkk
    grglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffhA (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraaelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtp
    eerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ffhB (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraagleaeapksakelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaik
    rleaivlsmtpeerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslekkk
    grglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffhB (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraaelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtp
    eerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ffhC (C:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraagleaeapksakelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaik
    rleaivlsmtpeerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslekkk
    grglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffhC (C:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraaelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtp
    eerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslek