PDB entry 2ffh

View 2ffh on RCSB PDB site
Description: the signal sequence binding protein ffh from thermus aquaticus
Class: protein transport
Keywords: ffh, srp54, signal recognition particle, gtpase, m domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting, protein transport
Deposited on 1999-06-29, released 1999-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.257
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ffh)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07347 (0-End)
      • see remark 999 (47)
    Domains in SCOPe 2.07: d2ffha1, d2ffha2, d2ffha3
  • Chain 'B':
    Compound: protein (ffh)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07347 (0-End)
      • see remark 999 (47)
    Domains in SCOPe 2.07: d2ffhb1, d2ffhb2, d2ffhb3
  • Chain 'C':
    Compound: protein (ffh)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07347 (0-End)
      • see remark 999 (47)
    Domains in SCOPe 2.07: d2ffhc1, d2ffhc2, d2ffhc3
  • Heterogens: CD, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ffhA (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraagleaeapksakelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaik
    rleaivlsmtpeerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslekkk
    grglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffhA (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraaelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtp
    eerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ffhB (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraagleaeapksakelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaik
    rleaivlsmtpeerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslekkk
    grglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffhB (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraaelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtp
    eerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ffhC (C:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraagleaeapksakelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaik
    rleaivlsmtpeerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslekkk
    grglm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffhC (C:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdvasl
    aekvraaelsledflkqmqnlkrlgpfseilgllpgvpqglkvdekaikrleaivlsmtp
    eerkdprilngsrrkriakgsgtsvqevnrfikafeemkalmkslek