PDB entry 2ffg

View 2ffg on RCSB PDB site
Description: Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360.
Class: structural genomics, unknown function
Keywords: X-Ray SR360 NESG YkuJ, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-12-19, released 2005-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.241
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ykuJ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykuJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34588 (Start-78)
      • modified residue (4)
      • modified residue (24)
      • modified residue (68)
      • cloning artifact (79-80)
    Domains in SCOPe 2.08: d2ffga1, d2ffga2
  • Chain 'B':
    Compound: ykuJ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ykuJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34588 (Start-78)
      • modified residue (4)
      • modified residue (24)
      • modified residue (68)
      • cloning artifact (79)
    Domains in SCOPe 2.08: d2ffgb2, d2ffgb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ffgA (A:)
msqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpn
typfdnidmvsieifellqlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2ffgA (A:)
sqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpnt
ypfdnidmvsieifellqle

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ffgB (B:)
msqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpn
typfdnidmvsieifellqlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2ffgB (B:)
sqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpnt
ypfdnidmvsieifellql