PDB entry 2ffd

View 2ffd on RCSB PDB site
Description: Fibrinogen Fragment D with "A" knob peptide mimic GPRVVE
Class: blood clotting
Keywords: Complex of fibrinogen with "A" site mimic GPRVVE in both "A" and "B" sites
Deposited on 2005-12-19, released 2006-07-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.214
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibrinogen alpha/alpha-E Chain
    Species: HOMO SAPIENS
    Gene: FGA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ffda1
  • Chain 'B':
    Compound: fibrinogen beta chain
    Species: HOMO SAPIENS
    Gene: FGB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fibrinogen gamma chain
    Species: HOMO SAPIENS
    Gene: FGG
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Fibrinogen alpha/alpha-E Chain
    Species: HOMO SAPIENS
    Gene: FGA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ffdd1
  • Chain 'E':
    Compound: fibrinogen beta chain
    Species: HOMO SAPIENS
    Gene: FGB
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Fibrinogen gamma chain
    Species: HOMO SAPIENS
    Gene: FGG
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
    Species: synthetic, synthetic
  • Chain 'I':
    Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
    Species: synthetic, synthetic
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ffdA (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffdA (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqvia
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ffdD (D:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffdD (D:)
    iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqvi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.