PDB entry 2ff4

View 2ff4 on RCSB PDB site
Description: Mycobacterium tuberculosis EmbR in complex with low affinity phosphopeptide
Class: transcription
Keywords: winged-helix; tetratricopeptide repeat; beta-sandwich
Deposited on 2005-12-19, released 2006-01-24
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable regulatory protein embR
    Species: Mycobacterium tuberculosis
    Gene: embR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ff4a1, d2ff4a2, d2ff4a3
  • Chain 'B':
    Compound: Probable regulatory protein embR
    Species: Mycobacterium tuberculosis
    Gene: embR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ff4b1, d2ff4b2, d2ff4b3
  • Chain 'E':
    Compound: DNA repair protein rad9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14737 (0-7)
      • modified residue (4)
  • Chain 'F':
    Compound: DNA repair protein rad9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14737 (Start-7)
      • modified residue (4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ff4A (A:)
    magsatvekrldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalw
    eewppsgarasihsyvsnlrkllggagidprvvlaaappgyrlsipdntcdlgrfvaekt
    agvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfatalvedkvlahtakaea
    eiacgrasaviaelealtfehpyreplwtqlitayylsdrqsdalgayrrvkttladdlg
    idpgptlralnerilrqqpldakksakttaagtvtvldqrtmasgqqavaylhdiasgrg
    yplqaaatrigrlhdndivldsanvsrhhavivdtgtnyvindlrssngvhvqherirsa
    vtlndgdhiricdheftfqisagthggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ff4A (A:)
    ekrldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsg
    arasihsyvsnlrkllggagidprvvlaaappgyrlsipdntcdlgrfvaektagvhaaa
    agrfeqasrhlsaalrewrgpvlddlrdfqfvepfatalvedkvlahtakaeaeiacgra
    saviaelealtfehpyreplwtqlitayylsdrqsdalgayrrvkttladdlgidpgptl
    ralnerilrqqpldakksakttaagtvtvldqrtmasgqqavaylhdiasgrgyplqaaa
    trigrlhdndivldsanvsrhhavivdtgtnyvindlrssngvhvqherirsavtlndgd
    hiricdheftfqisagthg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ff4B (B:)
    magsatvekrldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalw
    eewppsgarasihsyvsnlrkllggagidprvvlaaappgyrlsipdntcdlgrfvaekt
    agvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfatalvedkvlahtakaea
    eiacgrasaviaelealtfehpyreplwtqlitayylsdrqsdalgayrrvkttladdlg
    idpgptlralnerilrqqpldakksakttaagtvtvldqrtmasgqqavaylhdiasgrg
    yplqaaatrigrlhdndivldsanvsrhhavivdtgtnyvindlrssngvhvqherirsa
    vtlndgdhiricdheftfqisagthggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ff4B (B:)
    ekrldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsg
    arasihsyvsnlrkllggagidprvvlaaappgyrlsipdntcdlgrfvaektagvhaaa
    agrfeqasrhlsaalrewrgpvlddlrdfqfvepfatalvedkvlahtakaeaeiacgra
    saviaelealtfehpyreplwtqlitayylsdrqsdalgayrrvkttladdlgidpgptl
    ralnerilrqqpldakksakttaagtvtvldqrtmasgqqavaylhdiasgrgyplqaaa
    trigrlhdndivldsanvsrhhavivdtgtnyvindlrssngvhvqherirsavtlndgd
    hiricdheftfqi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.