PDB entry 2fez

View 2fez on RCSB PDB site
Description: Mycobacterium tuberculosis EmbR
Class: transcription
Keywords: transcriptional regulator; winged-helix; tetratricopeptide repeat; beta-sandwich;
Deposited on 2005-12-17, released 2006-01-24
The last revision prior to the SCOP 1.75 freeze date was dated 2006-05-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable regulatory protein embR
    Species: Mycobacterium tuberculosis
    Gene: embR
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2feza1, d2feza2, d2feza3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fezA (A:)
    magsatvekrldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalw
    eewppsgarasihsyvsnlrkllggagidprvvlaaappgyrlsipdntcdlgrfvaekt
    agvhaaaagrfeqasrhlsaalrewrgpvlddlrdfqfvepfatalvedkvlahtakaea
    eiacgrasaviaelealtfehpyreplwtqlitayylsdrqsdalgayrrvkttladdlg
    idpgptlralnerilrqqpldakksakttaagtvtvldqrtmasgqqavaylhdiasgrg
    yplqaaatrigrlhdndivldsanvsrhhavivdtgtnyvindlrssngvhvqherirsa
    vtlndgdhiricdheftfqisagthggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fezA (A:)
    rldfgllgplqmtidgtpvpsgtpkqravlamlvinrnrpvgvdalitalweewppsgar
    asihsyvsnlrkllggagidprvvlaaappgyrlsipdntcdlgrfvaektagvhaaaag
    rfeqasrhlsaalrewrgpvlddlrdfqfvepfatalvedkvlahtakaeaeiacgrasa
    viaelealtfehpyreplwtqlitayylsdrqsdalgayrrvkttladdlgidpgptlra
    lnerilrqqpldakksakttaagtvtvldqrtmasgqqavaylhdiasgrgyplqaaatr
    igrlhdndivldsanvsrhhavivdtgtnyvindlrssngvhvqherirsavtlndgdhi
    ricdheftfqisa