PDB entry 2fex

View 2fex on RCSB PDB site
Description: The Crystal Structure of DJ-1 Superfamily Protein Atu0886 from Agrobacterium tumefaciens
Class: structural genomics, unknown function
Keywords: structural genomics, protein structure initiative, psi, midwest center for structural genomics, mcsg
Deposited on 2005-12-16, released 2006-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Agrobacterium tumefaciens str. C58
    Gene: Atu0886
    Database cross-references and differences (RAF-indexed):
    • GB AAL41900 (0-187)
      • modified residue (0)
      • modified residue (39)
      • modified residue (44)
    Domains in SCOP 1.75: d2fexa1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Agrobacterium tumefaciens str. C58
    Gene: Atu0886
    Database cross-references and differences (RAF-indexed):
    • GB AAL41900 (0-187)
      • modified residue (0)
      • modified residue (39)
      • modified residue (44)
    Domains in SCOP 1.75: d2fexb1
  • Chain 'C':
    Compound: conserved hypothetical protein
    Species: Agrobacterium tumefaciens str. C58
    Gene: Atu0886
    Database cross-references and differences (RAF-indexed):
    • GB AAL41900 (0-187)
      • modified residue (0)
      • modified residue (39)
      • modified residue (44)
    Domains in SCOP 1.75: d2fexc1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fexA (A:)
    mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydald
    pvdidalvipgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtg
    nalashkaypayrgeahyrdqpravsdggvvtaagsapvsfaveilkslglfgpeaeael
    qifaaehr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fexB (B:)
    mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydald
    pvdidalvipgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtg
    nalashkaypayrgeahyrdqpravsdggvvtaagsapvsfaveilkslglfgpeaeael
    qifaaehr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fexC (C:)
    mtriaialaqdfadwepallaaaarsylgveivhatpdgmpvtsmgglkvtpdtsydald
    pvdidalvipgglswekgtaadlgglvkrfrdrdrlvagicaaasalggtgvlndvahtg
    nalashkaypayrgeahyrdqpravsdggvvtaagsapvsfaveilkslglfgpeaeael
    qifaaehr