PDB entry 2few

View 2few on RCSB PDB site
Description: Complex of enzyme IIAMTL and phosphorylated enzyme IIBMTL from Escherichia coli NMR, restrained regularized mean structure
Class: transferase
Keywords: phosphotransferase, transferase, kinase, sugar transport, complex (transferase/phosphocarrier)
Deposited on 2005-12-16, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system mannitol-specific EIICBA component
    Species: Escherichia coli [TaxId:562]
    Gene: MTLA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00550
      • engineered (64)
    Domains in SCOPe 2.08: d2fewa_
  • Chain 'B':
    Compound: mannitol-specific PTS system enzyme IIABC components
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Database cross-references and differences (RAF-indexed):
    • GB BAB37898 (0-End)
      • engineered (9)
    Domains in SCOPe 2.08: d2fewb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fewA (A:)
    manlfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylges
    iavpqgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltn
    alddesvierlahttsvdevlellagrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fewA (A:)
    lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
    pqgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
    desvierlahttsvdevlellagr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fewB (B:)
    shvrkiivasdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
    eramrqvpqaqhisltnfldsglytslterlvaaqrhtene
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fewB (B:)
    shvrkiivasdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
    eramrqvpqaqhisltnfldsglytslterlvaaqrh