PDB entry 2feu

View 2feu on RCSB PDB site
Description: P450CAM from Pseudomonas putida reconstituted with manganic protoporphyrin IX
Class: oxidoreductase
Keywords: MONO-OXYGENASE, HEME, Manganic, Substrate-bound, OXIDOREDUCTASE
Deposited on 2005-12-16, released 2006-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.214
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2feua_
  • Chain 'B':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2feub_
  • Heterogens: K, MNR, CAM, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2feuA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2feuA (A:)
    laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
    ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
    iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
    mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
    dtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgv
    qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
    lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2feuB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2feuB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
    lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav