PDB entry 2fej

View 2fej on RCSB PDB site
Description: Solution structure of human p53 DNA binding domain.
Class: transcription
Keywords: beta sandwich, transcription
Deposited on 2005-12-16, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2feja_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fejA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfr
    hsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevr
    vcacpgrdrrteeenlrkkgephh