PDB entry 2fei

View 2fei on RCSB PDB site
Description: Solution structure of the second SH3 domain of Human CMS protein
Class: structural protein
Keywords: CMS SH3 domain, STRUCTURAL PROTEIN
Deposited on 2005-12-15, released 2006-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD2-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5K6 (1-56)
      • initiating methionine (0)
      • expression tag (57-59)
    Domains in SCOPe 2.06: d2feia1, d2feia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2feiA (A:)
    mrqckvlfeyipqnedelelkvgdiidineeveegwwsgtlnnklglfpsnfvkeleleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2feiA (A:)
    mrqckvlfeyipqnedelelkvgdiidineeveegwwsgtlnnklglfpsnfvkeleleh