PDB entry 2fec

View 2fec on RCSB PDB site
Description: Structure of the E203Q mutant of the Cl-/H+ exchanger CLC-ec1 from E.Coli
Class: proton transport,membrane protein
Keywords: CLC-ec1; CLCA_ECOLI; Chloride/Proton exchange transporter
Deposited on 2005-12-15, released 2006-01-03
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.97 Å
R-factor: 0.272
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (202)
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (202)
  • Chain 'I':
    Compound: Fab fragment, heavy chain
    Species: HOMO SAPIENS
  • Chain 'J':
    Compound: Fab fragment, heavy chain
    Species: HOMO SAPIENS
  • Chain 'L':
    Compound: Fab fragment, light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d2fecl1, d2fecl2
  • Chain 'O':
    Compound: Fab fragment, light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d2feco1, d2feco2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fecL (L:)
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
tkdeyerhnsytceathktstspivksfnra

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fecO (O:)
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
tkdeyerhnsytceathktstspivksfnra