PDB entry 2feb

View 2feb on RCSB PDB site
Description: NMR Solution Structure, Dynamics and Binding Properties of the Kringle IV Type 8 module of apolipoprotein(a)
Class: hydrolase
Keywords: tri-loop structure, disulphide bonded protein, HYDROLASE
Deposited on 2005-12-15, released 2006-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apolipoprotein(a)
  Species: Homo sapiens [TaxId:9606]
  Gene: LPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08519 (6-101)
    • cloning artifact (0-5)
  Domains in SCOPe 2.05: d2feba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2febA (A:)
  iegrhmaptenstgvqdcyrgdgqsyrgtlsttitgrtcqswssmtphwhrriplyypna
  gltrnycrnpdaeirpwcytmdpsvrweycnltrcpvtessv