PDB entry 2fe5

View 2fe5 on RCSB PDB site
Description: The Crystal Structure of the Second PDZ Domain of Human DLG3
Class: structural protein
Keywords: PDZ domain, DLG3, Human, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-12-15, released 2005-12-27
The last revision prior to the SCOP 1.75 freeze date was dated 2005-12-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.115
AEROSPACI score: 1.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Presynaptic protein SAP102
  Species: HOMO SAPIENS
  Gene: DLG3, KIAA1232
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92796 (2-93)
    • cloning artifact (0-1)
  Domains in SCOP 1.75: d2fe5a1
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fe5A (A:)
  smtimevnllkgpkglgfsiaggignqhipgdnsiyitkiieggaaqkdgrlqigdrlla
  vnntnlqdvrheeavaslkntsdmvylkvakpgs