PDB entry 2fe1

View 2fe1 on RCSB PDB site
Description: Crystal Structure of PAE0151 from Pyrobaculum aerophilum
Class: structural genomics, unknown function
Keywords: pin domain, structural genomics, unknown function
Deposited on 2005-12-15, released 2005-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein PAE0151
    Species: Pyrobaculum aerophilum [TaxId:178306]
    Gene: PAE0151
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZZP3 (25-End)
      • engineered (26)
    Domains in SCOPe 2.08: d2fe1a1
  • Heterogens: MN, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fe1A (A:)
    msyyhhhhhhdydipttenlyfqgamelvvdasaiaalyvpeerseqaeravsqaqelht
    ldlaayevandlwkharrgllredeasnmleelweffkalkvhsyaevlkdafalalkhg
    vtvydaayvalaekiggklltldrqlaekfpalvtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fe1A (A:)
    melvvdasaiaalyvpeerseqaeravsqaqelhtldlaayevandlwkharrgllrede
    asnmleelweffkalkvhsyaevlkdafalalkhgvtvydaayvalaekiggklltldrq
    laekfpalvt