PDB entry 2fdx

View 2fdx on RCSB PDB site
Description: clostridium beijerinckii flavodoxin mutant n137a oxidized
Deposited on 1996-12-24, released 1997-04-01
The last revision prior to the SCOP 1.57 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.19
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2fdx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fdx_ (-)
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiaai