PDB entry 2fds

View 2fds on RCSB PDB site
Description: Crystal Structure of Plasmodium Berghei Orotidine 5'-monophosphate Decarboxylase (ortholog of Plasmodium falciparum PF10_0225)
Class: structural genomics, unknown function
Keywords: TIM barrel, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2005-12-14, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine-monophosphate-decarboxylase
    Species: Plasmodium berghei [TaxId:5821]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fdsa1
  • Chain 'B':
    Compound: orotidine-monophosphate-decarboxylase
    Species: Plasmodium berghei [TaxId:5821]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fdsb_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fdsA (A:)
    mgsshhhhhhssglvprgshfktklknrrnevntclcigldpdeddiknfmrneekngyk
    nvknnmnsnnnrienvikigkeilltdeenienlseedkffyffnhfcfyiinntkeyal
    iykmnfafyipygsvginalknvfdylnsmniptmldmkindigntvknyrkfifeylks
    dsctinvymgtsmlkdicfdyeknkyysayvlikttnkdsfifqnelsindkqayivmae
    etqkmatdlkidqnnefigfvvgsnafeemkiirnkfpdsyilspgigaqngdlyktlkn
    gynkdyekllinvgraitkspnpkkssesyynqiiqifkdienggnieqvyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdsA (A:)
    hfktklknrrnevntclcigldpdeddiknfmrneekngyknvknnmnnnnrienvikig
    keilltdeenienlseedkffyffnhfcfyiinntkeyaliykmnfafyipygsvginal
    knvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtsmlkdicfd
    yeknkyysayvlikttnkdsfifqnelsindkqayivmaeetqkmatdlkidqnnefigf
    vvgsnafeemkiirnkfpdsyilspgidlyktlkngynkdyekllinvgraitkspnpkk
    ssesyynqiiqifkdien
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fdsB (B:)
    mgsshhhhhhssglvprgshfktklknrrnevntclcigldpdeddiknfmrneekngyk
    nvknnmnsnnnrienvikigkeilltdeenienlseedkffyffnhfcfyiinntkeyal
    iykmnfafyipygsvginalknvfdylnsmniptmldmkindigntvknyrkfifeylks
    dsctinvymgtsmlkdicfdyeknkyysayvlikttnkdsfifqnelsindkqayivmae
    etqkmatdlkidqnnefigfvvgsnafeemkiirnkfpdsyilspgigaqngdlyktlkn
    gynkdyekllinvgraitkspnpkkssesyynqiiqifkdienggnieqvyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdsB (B:)
    hfktklknrrnevntclcigldpdeddiknfmrneekngyknvknnmnsnnnrienviki
    gkeilltdeenienlseedkffyffnhfcfyiinntkeyaliykmnfafyipygsvgina
    lknvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtsmlkdicf
    dyeknkyysayvlikttnkdsfifqnelsindkqayivmaeetqkmatdlkidqnnefig
    fvvgsnafeemkiirnkfpdsyilspgidlyktlkngynkdyekllinvgraitkspnpk
    kssesyynqiiqifkdien