PDB entry 2fdj

View 2fdj on RCSB PDB site
Description: Crystal Structure of AlkB in complex with Fe(II) and succinate
Class: oxidoreductase
Keywords: beta jellyroll, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, OXIDOREDUCTASE
Deposited on 2005-12-14, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylated DNA repair protein alkB
    Species: Escherichia coli [TaxId:83333]
    Gene: alkB, aidD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05050 (Start-205)
      • cloning artifact (206-209)
    Domains in SCOPe 2.07: d2fdja2, d2fdja3
  • Heterogens: FE2, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fdjA (A:)
    mqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwt
    thrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklsl
    hqdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiq
    plkagfhpltidcrynltfrqagkkenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdjA (A:)
    eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
    rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhq
    dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
    kagfhpltidcrynltfrqagkkenlyf