PDB entry 2fdg

View 2fdg on RCSB PDB site
Description: Crystal Structure of AlkB in complex with Fe(II), succinate, and methylated trinucleotide T-meA-T
Class: oxidoreductase/DNA
Keywords: beta jellyroll, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, OXIDOREDUCTASE-DNA COMPLEX
Deposited on 2005-12-13, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylated DNA repair protein alkB
    Species: Escherichia coli [TaxId:83333]
    Gene: alkB, aidD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fdga_
  • Chain 'B':
    Compound: 5'-d(p*tp*(ma7)p*t)-3'
  • Heterogens: FE2, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fdgA (A:)
    mqeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwt
    thrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklsl
    hqdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiq
    plkagfhpltidcrynltfrqagkkenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdgA (A:)
    laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq
    gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk
    depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
    gfhpltidcrynltfrqagk
    

  • Chain 'B':
    No sequence available.