PDB entry 2fdc

View 2fdc on RCSB PDB site
Description: Structural Basis of DNA Damage Recognition and Processing by UvrB: crystal structure of a UvrB/DNA complex
Class: DNA binding protein/DNA
Keywords: Protein-DNA complex, UvrB, UvrC, UvrD, UvrA, NER, nucleotide excision repair, DNA repair
Deposited on 2005-12-13, released 2006-03-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.21
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UvrABC system protein B
    Species: Bacillus caldotenax
    Gene: uvrB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fdca1, d2fdca2
  • Chain 'B':
    Compound: UvrABC system protein B
    Species: Bacillus caldotenax
    Gene: uvrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56981 (0-End)
      • see remark 999 (188)
      • see remark 999 (232)
    Domains in SCOP 1.73: d2fdcb1, d2fdcb2
  • Chain 'C':
    Compound: 5'-d(p*cp*gp*gp*cp*tp*cp*cp*ap*tp*cp*tp*cp*tp*ap*cp*cp*gp*cp*ap*a)-3'
  • Chain 'D':
    Compound: 5'-d(p*cp*gp*gp*cp*tp*cp*cp*ap*tp*cp*tp*cp*tp*ap*cp*cp*gp*cp*ap*a)-3'
  • Heterogens: FLQ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fdcA (A:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseik
    tlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
    aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdviraty
    aaeetemyeakpaaamtkqereelirtleaemkeaakaldferaaqlrdiifelkaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdcA (A:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvifpashfvtreekmrlaiqni
    eqeleerlaelraqgklleaqrleqrtrydlemmremgfcsgienysrhlalrppgstpy
    tlldyfpddfliivdeshvtlpqlrgmyngdrarkqvlvdhgfrlpsaldnrpltfeefe
    qkinqiiyvsatpgpyelehspgvveqiirptglldptidvrptkgqiddligeirerve
    rnertlvttltkkmaedltdylkeagikvaylherieiirdlrlgkydvlvginllregl
    dipevslvaildadkegflrsersliqtigraarnanghvimyadtitksmeiaiqetkr
    rraiqeeynrkhgivprtvkkeird
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fdcB (B:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseik
    tlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
    aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdviraty
    aaeetemyeakpaaamtkqereelirtleaemkeaakaldferaaqlrdiifelkaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdcB (B:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhieii
    rdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigraarnangh
    vimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeir
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.