PDB entry 2fdb

View 2fdb on RCSB PDB site
Description: Crystal Structure of Fibroblast growth factor (FGF)8b in complex with FGF Receptor (FGFR) 2c
Class: hormone/growth factor/transferase
Keywords: beta-trefoil fold; immunoglobulin fold, HORMONE/GROWTH FACTOR/TRANSFERASE COMPLEX
Deposited on 2005-12-13, released 2006-02-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.239
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: fibroblast growth factor 8 isoform B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fdbm1
  • Chain 'N':
    Compound: fibroblast growth factor 8 isoform B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fdbn_
  • Chain 'P':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQH9
      • engineered (104)
    Domains in SCOPe 2.05: d2fdbp1, d2fdbp2
  • Chain 'R':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KSAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQH9
      • engineered (104)
    Domains in SCOPe 2.05: d2fdbr1, d2fdbr2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2fdbM (M:)
    qvtvqsspnftqhvreqslvtdqlsrrlirtyqlysrtsgkhvqvlankrinamaedgdp
    faklivetdtfgsrvrvrgaetglyicmnkkgkliaksngkgkdcvfteivlennytalq
    nakyegwymaftrkgrprkgsktrqhqrevhfmkrlprghhtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdbM (M:)
    ftqhvreqslvtdqlsrrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetd
    tfgsrvrvrgaetglyicmnkkgkliaksngkgkdcvfteivlennytalqnakyegwym
    aftrkgrprkgsktrqhqrevhfmkrlpr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2fdbN (N:)
    qvtvqsspnftqhvreqslvtdqlsrrlirtyqlysrtsgkhvqvlankrinamaedgdp
    faklivetdtfgsrvrvrgaetglyicmnkkgkliaksngkgkdcvfteivlennytalq
    nakyegwymaftrkgrprkgsktrqhqrevhfmkrlprghhtte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdbN (N:)
    ftqhvreqslvtdqlsrrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetd
    tfgsrvrvrgaetglyicmnkkgkliaksngkgkdcvfteivlennytalqnakyegwym
    aftrkgrprkgsktrqhqrevhfmkrlp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2fdbP (P:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievly
    irnvtfedageytclagnsigisfhsawltvlpapgreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdbP (P:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvylkvlkaagvnttdkeievlyirnvtfedageytcl
    agnsigisfhsawltvl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2fdbR (R:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanast
    vvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievly
    irnvtfedageytclagnsigisfhsawltvlpapgreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdbR (R:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversrhrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvylkvlkaagvievlyirnvtfedageytclagnsig
    isfhsawltvl