PDB entry 2fd6

View 2fd6 on RCSB PDB site
Description: Structure of Human Urokinase Plasminogen Activator in Complex with Urokinase Receptor and an anti-upar antibody at 1.9 A
Class: immune system, hydrolase
Keywords: uPAR, ATF, ATN-615 antibody, Fab, crystal structure, ternary complex
Deposited on 2005-12-13, released 2006-02-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.239
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urokinase-type plasminogen activator
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fd6a1, d2fd6a2
  • Chain 'H':
    Compound: H chain of Fab of ATN-615 anti-uPAR antibody
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: L chain of Fab of ATN-615 anti-uPAR antibody
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Urokinase plasminogen activator surface receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03405 (2-275)
      • cloning artifact (1)
  • Heterogens: NAG, SO4, ETX, PG4, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fd6A (A:)
    cdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfyrgkastdtmgrp
    clpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvglkplvqecmvhd
    ca
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'U':
    No sequence available.