PDB entry 2fd5

View 2fd5 on RCSB PDB site
Description: The crystal structure of a transcriptional regulator from Pseudomonas aeruginosa PAO1
Class: transcription regulator
Keywords: Transcriptional regulator, DNA-binding protein, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION REGULATOR
Deposited on 2005-12-13, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: GI:15598329
    Database cross-references and differences (RAF-indexed):
    • GB AAG06521 (0-179)
    Domains in SCOPe 2.07: d2fd5a1, d2fd5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fd5A (A:)
    msdkktqtrarilgaatqallergavepsvgevmgaagltvggfyahfqskdalmleafe
    qllgkrrellgeldpglsgkerralaaafylsrkhrdaqvdagcplpatlaevarlpegf
    revlsrhveimvtslaespeetdvaladlvlmigglalaralgpgelsdrvlraakqavn