PDB entry 2fd2

View 2fd2 on RCSB PDB site
Description: crystallographic analysis of two site-directed mutants of azotobacter vinelandii ferredoxin
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1990-08-20, released 1990-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.232
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • conflict (23)
    Domains in SCOPe 2.07: d2fd2a_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fd2A (A:)
    afvvtdncikckytdcvevcpvdafyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler