PDB entry 2fd2

View 2fd2 on RCSB PDB site
Description: crystallographic analysis of two site-directed mutants of azotobacter vinelandii ferredoxin
Deposited on 1990-08-20, released 1990-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.232
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2fd2__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fd2_ (-)
  afvvtdncikckytdcvevcpvdafyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler