PDB entry 2fcw

View 2fcw on RCSB PDB site
Description: Structure of a Complex Between the Pair of the LDL Receptor Ligand-Binding Modules 3-4 and the Receptor Associated Protein (RAP).
Class: lipid transport/endocytosis/chaperone
Keywords: protein-protein complex, RAP, LDLR, escort protein, calcium-binding, LIPID TRANSPORT/ENDOCYTOSIS/CHAPERONE COMPLEX
Deposited on 2005-12-12, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.152
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-2-macroglobulin receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30533 (0-End)
      • engineered (0)
    Domains in SCOPe 2.08: d2fcwa1
  • Chain 'B':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LDLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fcwb1, d2fcwb2
  • Heterogens: CA, NA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fcwA (A:)
    gaefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqleiaheklrha
    esvgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarhnel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcwA (A:)
    gaefeeprvidlwdlaqsanltdkeleafreelkhfeakiekhnhyqkqleiaheklrha
    esvgdgervsrsrekhallegrtkelgytvkkhlqdlsgrisrarh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fcwB (B:)
    ktcsqaefrchdgkcisrqfvcdsdrdcldgsdeascpvltcgpasfqcnsstcipqlwa
    cdndpdcedgsdewpqrcrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcwB (B:)
    ktcsqaefrchdgkcisrqfvcdsdrdcldgsdeascpvltcgpasfqcnsstcipqlwa
    cdndpdcedgsdewpqrc