PDB entry 2fcu

View 2fcu on RCSB PDB site
Description: SyrB2 with alpha-ketoglutarate
Class: biosynthetic protein
Keywords: mononuclear iron, cupin, halogenase
Deposited on 2005-12-12, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: syringomycin biosynthesis enzyme 2
    Species: Pseudomonas syringae pv. syringae
    Gene: SyrB2
    Database cross-references and differences (RAF-indexed):
    • GB AAD50521 (Start-312)
    Domains in SCOP 1.73: d2fcua1
  • Chain 'B':
    Compound: syringomycin biosynthesis enzyme 2
    Species: Pseudomonas syringae pv. syringae
    Gene: SyrB2
    Database cross-references and differences (RAF-indexed):
    • GB AAD50521 (Start-312)
    Domains in SCOP 1.73: d2fcub1
  • Heterogens: DSU, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fcuA (A:)
    gshmskkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldai
    sggtnianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhq
    adtfanasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmt
    yepdannsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhas
    yphsgesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrl
    vthttrgkkfeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcuA (A:)
    skkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggt
    nianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtf
    anasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepd
    annsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphs
    gesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvtht
    trgkkfeav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fcuB (B:)
    gshmskkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldai
    sggtnianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhq
    adtfanasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmt
    yepdannsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhas
    yphsgesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrl
    vthttrgkkfeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcuB (B:)
    kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldtnianyd
    rhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfanasgk
    pqiiwpfggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdannsvvkdgv
    rrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsgesqemrmgf
    asryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttrgkkfeav