PDB entry 2fct

View 2fct on RCSB PDB site
Description: SyrB2 with Fe(II), chloride, and alpha-ketoglutarate
Class: biosynthetic protein
Keywords: mononuclear iron, cupin, halogenase, BIOSYNTHETIC PROTEIN
Deposited on 2005-12-12, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: syringomycin biosynthesis enzyme 2
    Species: Pseudomonas syringae [TaxId:321]
    Gene: SyrB2
    Database cross-references and differences (RAF-indexed):
    • GB AAD50521 (Start-312)
    Domains in SCOPe 2.08: d2fcta1
  • Chain 'B':
    Compound: syringomycin biosynthesis enzyme 2
    Species: Pseudomonas syringae [TaxId:321]
    Gene: SyrB2
    Database cross-references and differences (RAF-indexed):
    • GB AAD50521 (Start-312)
    Domains in SCOPe 2.08: d2fctb_
  • Heterogens: FE2, CL, DSU, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fctA (A:)
    gshmskkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldai
    sggtnianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhq
    adtfanasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmt
    yepdannsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhas
    yphsgesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrl
    vthttrgkkfeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fctA (A:)
    kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldatniany
    drhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfanasg
    kpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdannsv
    vkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsgesqe
    mrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttrgkk
    feav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fctB (B:)
    gshmskkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldai
    sggtnianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhq
    adtfanasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmt
    yepdannsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhas
    yphsgesqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrl
    vthttrgkkfeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fctB (B:)
    kfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdnianydrhld
    ddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfanasgkpqii
    wpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdannsvvkdgv
    rrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsgesqemrmgf
    asryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttrgkkfeav