PDB entry 2fcr

View 2fcr on RCSB PDB site
Description: crystal structure of oxidized flavodoxin from a red alga chondrus crispus refined at 1.8 angstroms resolution: description of the flavin mononucleotide binding site
Deposited on 1992-02-03, released 1992-01-15
The last revision prior to the SCOP 1.59 freeze date was dated 1992-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d2fcr__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fcr_ (-)
  kigiffststgnttevadfigktlgakadapidvddvtdpqalkdydllflgaptwntga
  dtersgtswdeflydklpevdmkdlpvaifglgdaegypdnfcdaieeihdcfakqgakp
  vgfsnpddydyeesksvrdgkflglpldmvndqipmekrvagwveavvsetgv