PDB entry 2fcp

View 2fcp on RCSB PDB site
Description: ferric hydroxamate uptake receptor (fhua) from e.coli
Deposited on 1998-10-15, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-12, with a file datestamp of 2000-01-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2fcpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fcpA (A:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnlynpshhhhhhgsvntdfdfnakdpansgpyrilnkq
    kqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfdng
    vtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktnnl
    madpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpaqv
    pkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydlarv
    gmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf