PDB entry 2fcn

View 2fcn on RCSB PDB site
Description: X-ray Crystal Structure of a Chemically Synthesized [D-Val35]Ubiquitin with a Cubic Space Group
Class: structural protein
Keywords: ubiquitin
Deposited on 2005-12-12, released 2006-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAH14880 (0-End)
      • engineered (0)
      • engineered (34)
    Domains in SCOP 1.73: d2fcna1
  • Chain 'B':
    Compound: Ubiquitin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAH14880 (0-End)
      • engineered (0)
      • engineered (34)
    Domains in SCOP 1.73: d2fcnb1
  • Heterogens: CD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fcnA (A:)
    lqifvktltgktitlevepsdtienvkakiqdkevippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcnA (A:)
    lqifvktltgktitlevepsdtienvkakiqdkevippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fcnB (B:)
    lqifvktltgktitlevepsdtienvkakiqdkevippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcnB (B:)
    lqifvktltgktitlevepsdtienvkakiqdkevippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrl