PDB entry 2fck

View 2fck on RCSB PDB site
Description: Structure of a putative ribosomal-protein-serine acetyltransferase from Vibrio cholerae.
Class: structural genomics, unknown function
Keywords: Vibrio cholerae, serine acetyltransferase, ribosomal-protein, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-12-12, released 2006-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal-protein-serine acetyltransferase, putative
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VC1889
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQV9 (3-180)
      • modified residue (3)
      • modified residue (85)
      • modified residue (97)
    Domains in SCOPe 2.08: d2fcka1
  • Heterogens: NO3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fckA (A:)
    snamtpdfqivtqrlqlrlitadeaeelvqcirqsqtlhqwvdwchalfsqqeaeqfiqa
    trlnwvkaeaygfgvferqtqtlvgmvainefyhtfnmaslgywigdryqrqgygkealt
    alilfcferleltrleivcdpenvpsqalalrcganreqlapnrflyagepkagivfsli
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fckA (A:)
    mtpdfqivtqrlqlrlitadeaeelvqcirqsqtlhqwvdwfsqqeaeqfiqatrlnwvk
    aeaygfgvferqtqtlvgmvainefyhtfnmaslgywigdryqrqgygkealtalilfcf
    erleltrleivcdpenvpsqalalrcganreqlapnrflyagepkagivfslip