PDB entry 2fcj

View 2fcj on RCSB PDB site
Description: Structure of small TOPRIM domain protein from Bacillus stearothermophilus.
Class: structural genomics, unknown function
Keywords: TOPRIM domain, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-12-12, released 2006-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.192
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: small TOPRIM domain protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP2199
    Database cross-references and differences (RAF-indexed):
    • PDB 2FCJ (0-End)
    Domains in SCOPe 2.06: d2fcja1
  • Chain 'B':
    Compound: small TOPRIM domain protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP2199
    Database cross-references and differences (RAF-indexed):
    • PDB 2FCJ (Start-118)
    Domains in SCOPe 2.06: d2fcjb_
  • Chain 'C':
    Compound: small TOPRIM domain protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP2199
    Database cross-references and differences (RAF-indexed):
    • PDB 2FCJ
    Domains in SCOPe 2.06: d2fcjc_
  • Heterogens: SO4, MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fcjA (A:)
    mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladad
    eageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcjA (A:)
    mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladad
    eageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fcjB (B:)
    mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladad
    eageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcjB (B:)
    rrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladade
    ageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fcjC (C:)
    mrrvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladad
    eageklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcjC (C:)
    rvekviivegrsdkqkvaavlnepvvivctngtisdarleeladelegydvylladadea
    geklrrqfrrmfpeaehlyidrayrevaaapiwhlaqvllrarfdvrieslmrgrg