PDB entry 2fch

View 2fch on RCSB PDB site
Description: Crystal Structure of Thioredoxin Mutant G74S
Class: electron transport
Keywords: Alpha Beta, Electron transport
Deposited on 2005-12-12, released 2005-12-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered (73)
    Domains in SCOPe 2.06: d2fcha_
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered (73)
    Domains in SCOPe 2.06: d2fchb_
  • Chain 'C':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (73)
    Domains in SCOPe 2.06: d2fchc_
  • Chain 'D':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (73)
    Domains in SCOPe 2.06: d2fchd_
  • Chain 'E':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (73)
    Domains in SCOPe 2.06: d2fche_
  • Chain 'F':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25
      • engineered (73)
    Domains in SCOPe 2.06: d2fchf_
  • Chain 'G':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (Start-107)
      • engineered (73)
    Domains in SCOPe 2.06: d2fchg_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fchA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fchA (A:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fchB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fchB (B:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fchC (C:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fchC (C:)
    kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fchD (D:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fchD (D:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fchE (E:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fchE (E:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fchF (F:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fchF (F:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2fchG (G:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fchG (G:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla