PDB entry 2fcf

View 2fcf on RCSB PDB site
Description: The crystal structure of the 7th PDZ domain of MPDZ (MUPP-1)
Class: structural protein
Keywords: Adaptor molecule, Protein linker, Structural Genomics, Structural Genomics Consortium, SGC, STRUCTURAL PROTEIN
Deposited on 2005-12-12, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.209
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Multiple PDZ domain protein
  Species: Homo sapiens [TaxId:9606]
  Gene: MPDZ, MUPP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5VZ62 (3-98)
    • cloning artifact (0-2)
    • cloning artifact (99-102)
  Domains in SCOPe 2.08: d2fcfa1, d2fcfa2, d2fcfa3
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2fcfA (A:)
  qsmqprrvelwrepskslgisivggrgmgsrlsngevmrgifikhvledspagkngtlkp
  gdrivevdgmdlrdasheqaveairkagnpvvfmvqsiistrl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2fcfA (A:)
  qsmqprrvelwrepkslgisivggrgifikhvledspagkngtlkpgdrivevdgmdlrd
  asheqaveairkagnpvvfmvqsiistrl