PDB entry 2fcc

View 2fcc on RCSB PDB site
Description: Crystal Structure of T4 Pyrimidine Dimer Glycosylase (T4-Pdg) Covalently Complexed with a DNA Substrate Containing Abasic Site
Class: hydrolase
Keywords: T4-Pdg, Pyrimidine Dimer, DNA repair, endonuclease, enzyme-DNA complex, covalent intermediate, HYDROLASE
Deposited on 2005-12-12, released 2006-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endonuclease v
  Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
  Gene: denV
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04418 (0-136)
  Domains in SCOPe 2.07: d2fcca_
• Chain 'B':
  Compound: endonuclease v
  Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
  Gene: denV
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04418 (0-136)
  Domains in SCOPe 2.07: d2fccb_
• Chain 'C':
  Compound: DNA (5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: DNA (5'-d(*gp*gp*cp*(bru)p*(bru)p*cp*ap*(bru)p*cp*cp*(bru)p*gp*g)-3')
  Species: synthetic, synthetic
  
• Chain 'E':
  Compound: DNA (5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: DNA (5'-d(*gp*gp*cp*(bru)p*(bru)p*cp*ap*(bru)p*cp*cp*(bru)p*gp*g)-3')
  Species: synthetic, synthetic
  
• Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fccA (A:)
  trinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
  dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
  iaqrptwykyygkaiya
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fccB (B:)
  trinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
  dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
  iaqrptwykyygkaiya
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.