PDB entry 2fcc
View 2fcc on RCSB PDB site
Description: Crystal Structure of T4 Pyrimidine Dimer Glycosylase (T4-Pdg) Covalently Complexed with a DNA Substrate Containing Abasic Site
Class: hydrolase
Keywords: T4-Pdg, Pyrimidine Dimer, DNA repair, endonuclease,
enzyme-DNA complex, covalent intermediate
Deposited on
2005-12-12, released
2006-10-03
The last revision prior to the SCOP 1.73 freeze date was dated
2006-10-03, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.249
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: endonuclease v
Species: Bacteriophage T4
Gene: denV
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2fcca1 - Chain 'B':
Compound: endonuclease v
Species: Bacteriophage T4
Gene: denV
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2fccb1 - Chain 'C':
Compound: DNA (5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3')
Species: synthetic, synthetic
- Chain 'D':
Compound: DNA (5'-d(*gp*gp*cp*(bru)p*(bru)p*cp*ap*(bru)p*cp*cp*(bru)p*gp*g)-3')
Species: synthetic, synthetic
- Chain 'E':
Compound: DNA (5'-d(*cp*cp*ap*gp*gp*ap*(ped)p*gp*ap*ap*gp*cp*c)-3')
Species: synthetic, synthetic
- Chain 'F':
Compound: DNA (5'-d(*gp*gp*cp*(bru)p*(bru)p*cp*ap*(bru)p*cp*cp*(bru)p*gp*g)-3')
Species: synthetic, synthetic
- Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2fccA (A:)
trinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
iaqrptwykyygkaiya
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2fccB (B:)
trinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
iaqrptwykyygkaiya
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.