PDB entry 2fcb

View 2fcb on RCSB PDB site
Description: human fc gamma receptor iib ectodomain (cd32)
Deposited on 1999-01-07, released 2000-03-01
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-01, with a file datestamp of 2000-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fcbA (A:)
    appkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkann
    ndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetivlrchswkdkplvkvtf
    fqngkskkfsrsdpnfsipqanhshsgdyhctgnigytlysskpvtitvqapa