PDB entry 2fcb

View 2fcb on RCSB PDB site
Description: human fc gamma receptor iib ectodomain (cd32)
Class: immune system
Keywords: receptor, fc, cd32, immune system
Deposited on 1999-01-07, released 2000-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fc gamma riib)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31994 (0-172)
      • conflict (172)
    Domains in SCOPe 2.08: d2fcba1, d2fcba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fcbA (A:)
appkavlklepqwinvlqedsvtltcrgthspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvlsewlvlqtphlefqegetivlrchswkdkplvkvtf
fqngkskkfsrsdpnfsipqanhshsgdyhctgnigytlysskpvtitvqapa