PDB entry 2fca

View 2fca on RCSB PDB site
Description: The structure of BsTrmB
Class: transferase
Keywords: methyltransferase, TRANSFERASE
Deposited on 2005-12-12, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(7)-)-methyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: trmB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34522 (Start-212)
      • conflict (8)
    Domains in SCOPe 2.08: d2fcaa1
  • Chain 'B':
    Compound: tRNA (guanine-N(7)-)-methyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: trmB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2fcab_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fcaA (A:)
    mrmrhkpwwddflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqn
    pdinyigielfksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpw
    pkkrhekrrltyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldl
    hnsnlegnimteyeekfsalgqpiyraevewrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcaA (A:)
    wddflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyigi
    elfksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhekr
    rltyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnlegn
    imteyeekfsalgqpiyraevewrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fcaB (B:)
    mrmrhkpwwddflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqn
    pdinyigielfksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpw
    pkkrhekrrltyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldl
    hnsnlegnimteyeekfsalgqpiyraevewrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fcaB (B:)
    dflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyigiel
    fksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhekrrl
    tyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnlegnim
    teyeekfsalgqpiyraevewrt