PDB entry 2fc7

View 2fc7 on RCSB PDB site
Description: Solution structure of the ZZ domain of ZZZ3 protein
Class: DNA binding protein
Keywords: NMR, structure genomics, ZZ domain, ZZZ3 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2005-12-12, released 2006-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ZZZ3 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ZZZ3
    Database cross-references and differences (RAF-indexed):
    • GB AAH35079 (7-75)
      • cloning artifact (0-6)
      • cloning artifact (76-81)
    Domains in SCOPe 2.08: d2fc7a1, d2fc7a2, d2fc7a3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fc7A (A:)
gssgssgqqmqaesgfvqhvgfkcdncgiepiqgvrwhcqdcppemsldfcdscsdclhe
tdihkedhqlepiyrssgpssg