PDB entry 2fc6

View 2fc6 on RCSB PDB site
Description: Solution structure of the zf-CCCH domain of target of EGR1, member 1 (Nuclear)
Class: transcription
Keywords: NMR, structure genomics, zf-CCCH domain, Target of EGR1,member 1(Nuclear), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-12-12, released 2006-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: target of EGR1, member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TOE1
    Database cross-references and differences (RAF-indexed):
    • GB CAI21722 (7-43)
      • cloning artifact (0-6)
      • cloning artifact (44-49)
    Domains in SCOPe 2.06: d2fc6a1, d2fc6a2, d2fc6a3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fc6A (A:)
    gssgssgcclppathrphptsicdnfsaygwcplgpqcpqshdisgpssg