PDB entry 2fbn

View 2fbn on RCSB PDB site
Description: Plasmodium falciparum putative FK506-binding protein PFL2275c, C-terminal TPR-containing domain
Class: structural genomics, unknown function
Keywords: Sulfur SAD, PFL2275c, TPR-containing domain, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2005-12-09, released 2006-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.201
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 70 kDa peptidylprolyl isomerase, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB NP_701815 (21-End)
    Domains in SCOPe 2.06: d2fbna1
  • Chain 'B':
    Compound: 70 kDa peptidylprolyl isomerase, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB NP_701815
    Domains in SCOPe 2.06: d2fbnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fbnA (A:)
    mgsshhhhhhssgrenlyfqgakksiydytdeekvqsafdikeegneffkkneineaivk
    ykealdffihteewddqilldkkknieiscnlnlatcynknkdypkaidhaskvlkidkn
    nvkalyklgvanmyfgfleeakenlykaaslnpnnldirnsyelcvnklkearkkdkltf
    ggmfdkgplyeekknsan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbnA (A:)
    akksiydytdeekvqsafdikeegneffkkneineaivkykealdffihteewddqilld
    kkknieiscnlnlatcynknkdypkaidhaskvlkidknnvkalyklgvanmyfgfleea
    kenlykaaslnpnnldirnsyelcvnklkeark
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fbnB (B:)
    mgsshhhhhhssgrenlyfqgakksiydytdeekvqsafdikeegneffkkneineaivk
    ykealdffihteewddqilldkkknieiscnlnlatcynknkdypkaidhaskvlkidkn
    nvkalyklgvanmyfgfleeakenlykaaslnpnnldirnsyelcvnklkearkkdkltf
    ggmfdkgplyeekknsan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbnB (B:)
    siydytdeekvqsafdikeegneffkkneineaivkykealdffihteewddqilldkkk
    nieiscnlnlatcynknkdypkaidhaskvlkidknnvkalyklgvanmyfgfleeaken
    lykaaslnpnnldirnsyelcvnklkearkk