PDB entry 2fbm

View 2fbm on RCSB PDB site
Description: Acetyltransferase domain of CDY1
Class: structural genomics, unknown function
Keywords: Acetyltransferase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-12-09, released 2005-12-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Y chromosome chromodomain protein 1, telomeric isoform b
    Species: HOMO SAPIENS
    Gene: CDY1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fbma1
  • Chain 'B':
    Compound: Y chromosome chromodomain protein 1, telomeric isoform b
    Species: HOMO SAPIENS
    Gene: CDY1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fbmb1
  • Chain 'C':
    Compound: Y chromosome chromodomain protein 1, telomeric isoform b
    Species: HOMO SAPIENS
    Gene: CDY1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fbmc1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fbmA (A:)
    mgsshhhhhhssglvprgsstyrdivvkkedgftqivlstrsteknalntevikeivnal
    nsaaaddsklvlfsaagsvfccgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkk
    pivvsvngpaiglgasilplcdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasa
    nemliagrkltareacakglvsqvfltgtftqevmiqikelasynpivleeckalvrcni
    kleleqanerecevlrkiwssaqgiesmlkipllgykaafpprktqndqrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbmA (A:)
    tyrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvf
    ccgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilpl
    cdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakgl
    vsqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiws
    saqgiesmlki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fbmB (B:)
    mgsshhhhhhssglvprgsstyrdivvkkedgftqivlstrsteknalntevikeivnal
    nsaaaddsklvlfsaagsvfccgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkk
    pivvsvngpaiglgasilplcdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasa
    nemliagrkltareacakglvsqvfltgtftqevmiqikelasynpivleeckalvrcni
    kleleqanerecevlrkiwssaqgiesmlkipllgykaafpprktqndqrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbmB (B:)
    yrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvfc
    cgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
    dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
    sqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiwss
    aqgiesmlki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fbmC (C:)
    mgsshhhhhhssglvprgsstyrdivvkkedgftqivlstrsteknalntevikeivnal
    nsaaaddsklvlfsaagsvfccgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkk
    pivvsvngpaiglgasilplcdlvwanekawfqtpyttfgqspdgcssitfpkmmgkasa
    nemliagrkltareacakglvsqvfltgtftqevmiqikelasynpivleeckalvrcni
    kleleqanerecevlrkiwssaqgiesmlkipllgykaafpprktqndqrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbmC (C:)
    yrdivvkkedgftqivlstrsteknalntevikeivnalnsaaaddsklvlfsaagsvfc
    cgldfgyfvkhlrnnrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
    dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
    sqvfltgtftqevmiqikelasynpivleeckalvrcnikleleqanerecevlrkiwss
    aqgiesmlki