PDB entry 2fbl

View 2fbl on RCSB PDB site
Description: The crystal structure of the hypothetical protein NE1496
Class: structural genomics, unknown function
Keywords: APC5855, NE1496, PSI, Protein structure initiative, MCSG, Midwest center for structural genomics
Deposited on 2005-12-09, released 2005-12-20
The last revision prior to the SCOP 1.73 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.221
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein NE1496
    Species: Nitrosomonas europaea
    Database cross-references and differences (RAF-indexed):
    • GB NP_841537 (Start-152)
    Domains in SCOP 1.73: d2fbla1
  • Chain 'B':
    Compound: hypothetical protein NE1496
    Species: Nitrosomonas europaea
    Database cross-references and differences (RAF-indexed):
    • GB NP_841537 (Start-152)
    Domains in SCOP 1.73: d2fblb1
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fblA (A:)
    ghmteierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsr
    qeyeiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlvevefls
    edaaqafipppwfgeevtedkryknkalalsip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fblA (A:)
    teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksqeyeiqidv
    tqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaqafip
    ppwfgeevtedkryknkalalsip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fblB (B:)
    ghmteierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsr
    qeyeiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlvevefls
    edaaqafipppwfgeevtedkryknkalalsip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fblB (B:)
    teierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlkseggrqeyei
    qidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaq
    afipppwfgeevtedkryknkalalsip