PDB entry 2fbk

View 2fbk on RCSB PDB site
Description: The Crystal Structure of HucR from Deinococcus radiodurans
Class: transcription
Keywords: winged-helix-turn-helix, TRANSCRIPTION
Deposited on 2005-12-09, released 2006-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, MarR family
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fbka1
  • Chain 'B':
    Compound: transcriptional regulator, MarR family
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fbkb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fbkA (A:)
    msarmdndtaallerirsdwarlnhgqgpdsdgltpsagpmltllllerlhaalgreier
    tyaasglnaagwdllltlyrsappeglrptelsalaaisgpstsnrivrllekglierre
    derdrrsasirltpqgralvthllpahlattqrvlaplsaqeqrtleelagrmlagleqg
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbkA (A:)
    dtaallerirsdwarlnhgpsagpmltllllerlhaalgreiertyaasglnaagwdlll
    tlyrsappeglrptelsalaaisgpstsnrivrllekglierreasirltpqgralvthl
    lpahlattqrvlaplsaqeqrtleelagrmlagleq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fbkB (B:)
    msarmdndtaallerirsdwarlnhgqgpdsdgltpsagpmltllllerlhaalgreier
    tyaasglnaagwdllltlyrsappeglrptelsalaaisgpstsnrivrllekglierre
    derdrrsasirltpqgralvthllpahlattqrvlaplsaqeqrtleelagrmlagleqg
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbkB (B:)
    dtaallerirsdwarlnhgpsagpmltllllerlhaalgreiertyaasglnaagwdlll
    tlyrsappeglrptelsalaaisgpstsnrivrllekglierreasirltpqgralvthl
    lpahlattqrvlaplsaqeqrtleelagrmlagleq