PDB entry 2fbj

View 2fbj on RCSB PDB site
Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1989-08-18, released 1990-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: iga-kappa j539 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fbjh1, d2fbjh2
  • Chain 'L':
    Compound: iga-kappa j539 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC28911 (0-211)
      • conflict (1)
      • conflict (10-11)
      • conflict (14)
      • conflict (40)
      • conflict (44)
      • conflict (48-49)
      • conflict (54)
      • conflict (74-75)
      • conflict (83)
      • conflict (85)
      • conflict (87)
      • conflict (90)
      • insertion (94)
    Domains in SCOPe 2.04: d2fbjl1, d2fbjl2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fbjH (H:)
    evkllesggglvqpggslklscaasgfdfskywmswvrqapgkglewigeihpdsgtiny
    tpslkdkfiisrdnaknslylqmskvrsedtalyycarlhyygynaywgqgtlvtvsaes
    arnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalasggr
    ytmsnqltlpavecpegesvkcsvqhdsnpvqeldvncsg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fbjL (L:)
    eivltqspaitaaslgqkvtitcsasssvsslhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltintmeaedaaiyycqqwtyplitfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec