PDB entry 2fbe

View 2fbe on RCSB PDB site
Description: Crystal Structure of the PRYSPRY-domain
Class: unknown function
Keywords: dimer, jellyroll beta-sandwich fold, UNKNOWN FUNCTION
Deposited on 2005-12-09, released 2006-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PREDICTED: similar to ret finger protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: gene 19q13.4.1
    Database cross-references and differences (RAF-indexed):
    • GB XP_292796 (7-End)
      • cloning artifact (0-6)
      • modified residue (11)
      • cloning artifact (92)
      • modified residue (117)
      • modified residue (137)
    Domains in SCOPe 2.07: d2fbea1, d2fbea2
  • Chain 'B':
    Compound: PREDICTED: similar to ret finger protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: gene 19q13.4.1
    Database cross-references and differences (RAF-indexed):
    • GB XP_292796 (7-End)
      • cloning artifact (0-6)
      • modified residue (11)
      • cloning artifact (92)
      • modified residue (117)
      • modified residue (137)
    Domains in SCOPe 2.07: d2fbeb2, d2fbeb3
  • Chain 'C':
    Compound: PREDICTED: similar to ret finger protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: gene 19q13.4.1
    Database cross-references and differences (RAF-indexed):
    • GB XP_292796 (7-End)
      • cloning artifact (0-6)
      • modified residue (11)
      • cloning artifact (92)
      • modified residue (117)
      • modified residue (137)
    Domains in SCOPe 2.07: d2fbec2, d2fbec3
  • Chain 'D':
    Compound: PREDICTED: similar to ret finger protein-like 1
    Species: Homo sapiens [TaxId:9606]
    Gene: gene 19q13.4.1
    Database cross-references and differences (RAF-indexed):
    • GB XP_292796 (7-End)
      • cloning artifact (0-6)
      • modified residue (11)
      • cloning artifact (92)
      • modified residue (117)
      • modified residue (137)
    Domains in SCOPe 2.07: d2fbed2, d2fbed3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fbeA (A:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvinpsaasapvssegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbeA (A:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fbeB (B:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvinpsaasapvssegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbeB (B:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvinpsaasapvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fbeC (C:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvinpsaasapvssegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbeC (C:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvinpsaasapvsse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fbeD (D:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvinpsaasapvssegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fbeD (D:)
    gplgspefqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprf
    tsgrhywevdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtp
    lwvspqlhrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsi
    lsicsvinps