PDB entry 2fb9

View 2fb9 on RCSB PDB site
Description: Crystal structure of the Apo form of D-alanine: D-alanine ligase (Ddl) from Thermus caldophilus: a basis for the substrate-induced conformational changes
Class: ligase
Keywords: ligase
Deposited on 2005-12-08, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-alanine:D-alanine ligase
    Species: Thermus caldophilus [TaxId:272]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3T920 (3-321)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d2fb9a1, d2fb9a2, d2fb9a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fb9A (A:)
mefmrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleaka
apegehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkd
lskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaala
lafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraell
ipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmypr
lfeaggvaypellrrlvelalt